PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01009721001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family ZF-HD
Protein Properties Length: 322aa    MW: 35750 Da    PI: 7.6658
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01009721001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer103.31.5e-32131188260
        ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                        ++vrY+eClkNhAa++Gg++vDGCgEfmp+ geegt +al CaAC+CHRnFHR+ev+ e
  GSVIVT01009721001 131 ASVRYRECLKNHAANIGGNVVDGCGEFMPD-GEEGTLEALMCAACNCHRNFHRKEVDGE 188
                        579**************************8.999*********************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257748.0E-23129186IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047704.2E-30133185IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.9E-30134185IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.049135184IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466892.56E-18206279IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-29212280IPR009057Homeodomain-like
PROSITE profilePS500719.183216280IPR001356Homeobox domain
TIGRFAMsTIGR015653.7E-27218275IPR006455Homeodomain, ZF-HD class
CDDcd000860.00511219279No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MFSLLISLNN NSLFGKSSGF EWVSILSRLM ELSKEMGFPP SSGYNPLASA GSGGGGDDHH  60
NIDNGTTVFK PPQIPHHHPL LQQQQELNPQ QQSLGQGCDP DPDPDPDPVH VAGVLAGATI  120
ASTIGGSNSK ASVRYRECLK NHAANIGGNV VDGCGEFMPD GEEGTLEALM CAACNCHRNF  180
HRKEVDGETI GRSLSRTPFN NHHPSHVHGF WDEHRRHRKR FRTKFTQEQK EKMLEYAEKV  240
GWRMQKQYEE QVQQLCAEVG VKRQVFKVWM HNNKNTLKKQ PQPQQQPPPL EQAPARTPEQ  300
TLSYSPSSSA NTKLAMIRSE T*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A4e-232192761875ZF-HD homeobox family protein
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.219180.0bud
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4512410.0AM451241.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X144196.4, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002281371.14e-84PREDICTED: zinc-finger homeodomain protein 6
TrEMBLF6H0495e-84F6H049_VITVI; Putative uncharacterized protein
STRINGVIT_18s0001g12580.t011e-83(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.11e-50homeobox protein 22